Antibodies

Jump to Filters
View as table Download
CDK1 pTyr15 Rabbit Polyclonal Antibody
AP20844PU-N

USD 495.00

3 Weeks

CDK1 pTyr15 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CDK1 pTyr15 Rabbit Polyclonal Antibody
AP20928PU-N

USD 495.00

3 Weeks

CDK1 pTyr15 rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CDK1 (C-term) Rabbit Polyclonal Antibody
R1002

USD 765.00

3 Days

CDK1 (C-term) rabbit polyclonal antibody, Serum

Applications ELISA, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen cdc2 peptide corresponding to the C-terminus of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH).
CDK1 Rabbit Polyclonal Antibody
TA302014

USD 580.00

5 Days

Rabbit Polyclonal Antibody against CDC2 (C-term)

Applications WB
Reactivities Human (Predicted: Mouse, Rat, Xenopus)
Conjugation Unconjugated
Immunogen This CDC2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 213-241 amino acids from the C-terminal region of human CDC2.
Cdk1 Rabbit Polyclonal Antibody
TA309089

USD 545.00

5 Days

Rabbit Anti-cdc2 (Tyr15) Antibody (Phospho-Specific)

Applications WB
Reactivities Human, Xenopus
Conjugation Unconjugated
Immunogen Synthetic phospho-peptide corresponding to amino acid residues surrounding Tyr15 conjugated to KLH
Modifications Phospho-specific
CDK1 Rabbit Polyclonal Antibody
TA330322

USD 539.00

5 Days

Rabbit Polyclonal Anti-CDK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the middle region of human CDC2. Synthetic peptide located within the following region: KLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGT
CDK1 Rabbit Polyclonal Antibody
TA344355

USD 539.00

5 Days

Rabbit Polyclonal Anti-CDC2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the middle region of human CDC2. Synthetic peptide located within the following region: CAICTLFYPYCQALQTEKEAPIASLGEGCPATLPSKSRQKTRPLIPEMCF
CDK1 Rabbit Polyclonal Antibody
TA344356

USD 539.00

5 Days

Rabbit Polyclonal Anti-CDC2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the middle region of human CDC2. Synthetic peptide located within the following region: DYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHP
CDK1 Rabbit Polyclonal Antibody
TA392729

USD 325.00

3 Weeks

Cdk1/Cdc2 (N133) polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 771-820 of Human Cdk1/Cdc2.
Phospho-CDK1 Rabbit Polyclonal Antibody
TA420076

USD 770.00

3 Weeks

Phospho-CDK1-Y15 Rabbit mAb

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic phosphorylated peptide around Y15 of human CDK1(NP_001777.1).