Antibodies

View as table Download

Rabbit polyclonal FGA Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This FGA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 116-144 amino acids from the N-terminal region of human FGA.

Rabbit Polyclonal Anti-FGA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FGA antibody: synthetic peptide directed towards the N terminal of human FGA. Synthetic peptide located within the following region: MFSMRIVCLVLSVVGTAWTADSGEGDFLAEGGGVRGPRVVERHQSACKDS

Rabbit Polyclonal Anti-FGA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FGA antibody: synthetic peptide directed towards the middle region of human FGA. Synthetic peptide located within the following region: SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHEGTHSTKRGHAK