Rabbit Polyclonal Anti-RNF5 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human RNF5 |
Rabbit Polyclonal Anti-RNF5 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human RNF5 |
RNF5 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 64-94 amino acids from the Central region of human RNF5 |
RNF5 (N-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human RNF5 |
Rabbit Polyclonal Anti-RNF5 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RNF5 antibody: synthetic peptide directed towards the N terminal of human RNF5. Synthetic peptide located within the following region: AAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCL |