Antibodies

View as table Download

USD 204.00

USD 407.00

In Stock

Rabbit polyclonal BAX Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH derived from within residues 100-170 of Human BAX.

Anti-BAX Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 2-172 amino acids of human BCL2-associated X protein

Rabbit polyclonal BAX Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH derived from within residues 100-170 of Human BAX.

Rabbit polyclonal anti-BAX antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human BAX.

Rabbit Polyclonal Anti-NCAM1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human NCAM1

Rabbit polyclonal anti-BAX antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human BAX.

Rabbit polyclonal Bax (Ab-167) antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Bax around the phosphorylation site of threonine 167 (F-G-TP-P-T)

Rabbit Polyclonal Bax Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human Bax.

Rabbit polyclonal anti-NCAM2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NCAM2.

Bax Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human Bax

Rabbit polyclonal Bax (Thr167) antibody(Phospho-specific)

Applications IF
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Bax around the phosphorylation site of threonine 167 (F-G-TP-P-T).
Modifications Phospho-specific

Rabbit Polyclonal Anti-CCL5 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CCL5 antibody: synthetic peptide directed towards the middle region of mouse CCL5. Synthetic peptide located within the following region: YGSDTTPCCFAYLSLELPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCAN

CD56 (NCAM1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the C-teminal end of human CD56

BAX (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a sequence mapping near the N-terminal of human BAX

Rabbit polyclonal anti-BAX antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human BAX.