Rabbit polyclonal BAX Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH derived from within residues 100-170 of Human BAX. |
Rabbit polyclonal BAX Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH derived from within residues 100-170 of Human BAX. |
Anti-BAX Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 2-172 amino acids of human BCL2-associated X protein |
Rabbit polyclonal BAX Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH derived from within residues 100-170 of Human BAX. |
Rabbit polyclonal anti-BAX antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human BAX. |
Rabbit Polyclonal Anti-NCAM1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human NCAM1 |
Rabbit polyclonal anti-BAX antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human BAX. |
Rabbit polyclonal Bax (Ab-167) antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Bax around the phosphorylation site of threonine 167 (F-G-TP-P-T) |
Rabbit Polyclonal Bax Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human Bax. |
Rabbit polyclonal anti-NCAM2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NCAM2. |
Bax Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human Bax |
Rabbit polyclonal Bax (Thr167) antibody(Phospho-specific)
Applications | IF |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Bax around the phosphorylation site of threonine 167 (F-G-TP-P-T). |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CCL5 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CCL5 antibody: synthetic peptide directed towards the middle region of mouse CCL5. Synthetic peptide located within the following region: YGSDTTPCCFAYLSLELPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCAN |
CD56 (NCAM1) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the C-teminal end of human CD56 |
BAX (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a sequence mapping near the N-terminal of human BAX |
Rabbit polyclonal anti-BAX antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human BAX. |