Antibodies

Jump to Filters
View as table Download
OR52E2 Rabbit Polyclonal Antibody
TA316039

USD 380.00

In Stock

Rabbit polyclonal anti-OR52E2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human OR52E2.
OR52E2 Rabbit Polyclonal Antibody
TA332300

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR52E2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR52E2 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR52E2. Synthetic peptide located within the following region: RYIHILLANLYVVVPPMLNPVIYGVRTKQIYKCVKKILLQEQGMEKEEYL