Antibodies

View as table Download

Rabbit polyclonal anti-OR2W3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR2W3.

Rabbit Polyclonal Anti-OR2W3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR2W3 antibody is: synthetic peptide directed towards the C-terminal region of Human OR2W3. Synthetic peptide located within the following region: IIYMYMQPGASSSQDQGMFLMLFYNIVTPLLNPLIYTLRNREVKGALGRL