Rabbit Polyclonal Anti-ACE Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ACE |
Rabbit Polyclonal Anti-ACE Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ACE |
Anti-AGT Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 34-43 amino acids of human angiotensinogen (serpin peptidase inhibitor, clade A, member 8) |
Rabbit Polyclonal ACE2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | ACE2 antibody was raised against a synthetic peptide corresponding to amino acids near the center of human ACE2. |
Anti-AGT Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 34-43 amino acids of human angiotensinogen (serpin peptidase inhibitor, clade A, member 8) |
Anti-AGT Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 34-41 amino acids of human angiotensinogen (serpin peptidase inhibitor, clade A, member 8) |
Anti-ACE2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 185-199 amino acids of Human Angiotensin-converting enzyme 2 |
Anti-ACE2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 185-199 amino acids of Human Angiotensin-converting enzyme 2 |
Anti-AGT Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 34-41 amino acids of human angiotensinogen (serpin peptidase inhibitor, clade A, member 8) |
Anti-ACE1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 78-92 amino acids of Human Angiotensin-converting enzyme |
REN Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Mouse, Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human REN |
Rabbit Polyclonal Anti-ACE2 Antibody
Applications | WB |
Reactivities | Mouse, Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACE2 Antibody: A synthesized peptide |
Rabbit Polyclonal Anti-REN Antibody
Applications | WB |
Reactivities | Mouse, Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-REN antibody: synthetic peptide directed towards the C terminal of human REN. Synthetic peptide located within the following region: YSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALA |
Rabbit Polyclonal Anti-ACE1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACE1 Antibody: A synthesized peptide derived from human ACE1 |
Rabbit Polyclonal Anti-AGT Antibody
Applications | ELISA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human AGT |