Antibodies

View as table Download

Rabbit Polyclonal Anti-DAG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DAG1 antibody: synthetic peptide directed towards the middle region of human DAG1. Synthetic peptide located within the following region: AIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRDPVPGKPTVTIRT

Rabbit Polyclonal Anti-Tgfb1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Tgfb1 antibody: synthetic peptide directed towards the middle region of mouse Tgfb1. Synthetic peptide located within the following region: SRAELRLQRLKSSVEQHVELYQKYSNNSWRYLGNRLLTPTDTPEWLSFDV

Rabbit polyclonal anti-TGF beta3 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human TGF β3.

Rabbit polyclonal TGF beta 1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen TGF beta 1 Antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids near the amino terminus of the mature growth factor (112 amino acids in length).

Rabbit polyclonal anti-IL-6 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This whole rabbit serum was prepared by repeated immunizations with recombinant human IL-6 produced in E.coli.

Rabbit Polyclonal Anti-TGF beta1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-TGF beta1 Antibody: The antiserum was produced against synthesized peptide derived from human TGF beta.

Rabbit Polyclonal Anti-ACE1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ACE1 Antibody: A synthesized peptide derived from human ACE1

Rabbit Polyclonal Anti-IGF1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-IGF1 antibody: A synthesized peptide derived from human IGF1

Rabbit Polyclonal TNFA Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human TNFA

Rabbit anti IGF-I Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit anti TGF-beta 2 Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A 21 aa of a synthetic peptide derived from C-terminus of human TGF-beta 2 protein.

Rabbit anti TGF beta Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide derived from C-terminus of human TGF-beta protein.

Rabbit anti TGF beta 1 Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen A Recombinant protein encoding human TGF beta 1 aa 177-391 expressed in E.Coli.