Rabbit Polyclonal Anti-F10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-F10 antibody: synthetic peptide directed towards the C terminal of human F10. Synthetic peptide located within the following region: STLMTQKTGIVSGFGRTHEKGRQSTRLKMLEVPYVDRNSCKLSSSFIITQ |
Rabbit Polyclonal Anti-F12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-F12 antibody: synthetic peptide directed towards the N terminal of human F12. Synthetic peptide located within the following region: MRALLLLGFLLVSLESTLSIPPWEAPKEHKYKAEEHTVVLTVTGEPCHFP |
Rabbit Polyclonal Anti-THRB Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-THRB Antibody: A synthesized peptide derived from human THRB |
C2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human C2 |
CPB2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CPB2 |
CFB Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CFB |
C4BPA rabbit polyclonal antibody, Serum
| Applications | ID, IP |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | C4-binding protein is a plasma protein with a molecular weight of 500,000 and consists of 6 chains. Its concentration in serum is about 250 μg/ml. It is one of the inhibitors of the complement activation system. The protein combines up to six molecules of C4b at or near the C2 combining site and is thus preventing further association with C2. It has been isolated as a homogenous protein for use in the antiserum production. Freund’s complete adjuvant is used in the first step of the immunization procedure |
Germany
Japan
United Kingdom
China