Antibodies

View as table Download

Rabbit Polyclonal Anti-SNAP29 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SNAP29

Rabbit Polyclonal Anti-SNAP29 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Snap29 antibody is: synthetic peptide directed towards the middle region of Rat Snap29. Synthetic peptide located within the following region: QPSSRLKEAINTSKDQESKYQASHPNLRRLHDAELDSVPASTVNTEVYPK