Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-ALDH2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Aldh2 antibody is synthetic peptide directed towards the C-terminal region of Mouse Aldh2. Synthetic peptide located within the following region: QPTVFGDVKDGMTIAKEEIFGPVMQILKFKTIEEVVGRANDSKYGLAAAV |
Rabbit Polyclonal EHMT1 Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EHMT1 antibody: mouse Ehmt1 (euchromatic histone-lysine N-methyltransferase 1), using three KLH-conjugated synthetic peptides containing a sequence from the central part of the protein. |
Rabbit Polyclonal G9a Antibody
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G9a antibody: mouse G9a (Protein G9a), using two KLH-conjugated synthetic peptides containing an amino acid sequence from the central part of the protein |
Rabbit Polyclonal Setd1a Antibody
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Setd1a antibody: mouse Setd1a (Set domain containing 1A), using three KLH-conjugated synthetic peptides: two containing an amino acid sequence from the N-terminal part of the protein and one containing an amino acid sequence from th |
Rabbit Polyclonal Setd1b Antibody
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Setd1b antibody: mouse Setd1b (Set domain containing 1B), using a 3 KLH-conjugated synthetic peptides containing sequences from the central part of the protein. |
Rabbit polyclonal anti-SUV39H2 antibody
| Applications | WB |
| Reactivities | Mouse, Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SUV39H2. |
Active filters
Reactivities
- Mouse
Antibody Hosts
- Rabbit
Isotypes
- IgG
Clonalities
- Polyclonal
Families
- Druggable Genome
Pathways
- Lysine degradation