Anti-BIRC2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human baculoviral IAP repeat containing 2 |
Anti-BIRC2 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human baculoviral IAP repeat containing 2 |
Rabbit polyclonal anti-Cullin 1 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Cullin 1. |
Rabbit polyclonal anti-Cullin 2 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Cullin 2. |
Rabbit Polyclonal Anti-SOCS1 Antibody
Applications | IHC, WB |
Reactivities | Rat, Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SOCS1 antibody: synthetic peptide directed towards the N terminal of human SOCS1. Synthetic peptide located within the following region: RRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRSHADYRRITRA |
Rabbit polyclonal MDM2 (Ab-166) antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human MDM2 around the phosphorylation site of serine 166 (A-I-SP-E-T). |
Anti-BIRC6 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 4842-4857 amino acids of Human Baculoviral IAP repeat-containing protein 6 |
Anti-BIRC6 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 4842-4857 amino acids of human baculoviral IAP repeat containing 6 |
Anti-BIRC6 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 4842-4857 amino acids of human baculoviral IAP repeat containing 6 |
Anti-RCHY1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-ANAPC10 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-ANAPC10 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-UBE2N Antibody
Applications | IHC, WB |
Reactivities | Mouse, Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-UBE2N Antibody: synthetic peptide directed towards the middle region of human UBE2N. Synthetic peptide located within the following region: GRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNE |
Rabbit Polyclonal Anti-FBXW7 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FBXW7 |
Rabbit Polyclonal Anti-NEDD4L Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human NEDD4L |
Rabbit Polyclonal Anti-SMURF1 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SMURF1 |