Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Human, Macaque |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Rabbit Polyclonal Anti-PAX7 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAX7 antibody: synthetic peptide directed towards the N terminal of human PAX7. Synthetic peptide located within the following region: KEEEDEADKKEDDGEKKAKHSIDGILGDKGNRLDEGSDVESEPDLPLKRK |
Rabbit polyclonal EGFR (Thr693) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 693 (P-L-TP-P-S). |
| Modifications | Phospho-specific |
Active filters
Reactivities
- Mouse
Antibody Hosts
- Rabbit
Isotypes
- IgG
Clonalities
- Polyclonal
Families
- Adult stem cells
Filter by
Category
Target Symbol
- EGFR (32)
- HDAC1 (11)
- FGF4 (7)
- GATA1 (7)
- SOX9 (7)
- CD117 (6)
- MAP2 (6)
- SOX1 (6)
- SOX2 (6)
- BDNF (5)
- CD44 (5)
- HNF1 ALPHA (5)
- OCT4 (5)
- CDX2 (4)
- GATA3 (4)
- NEUROD1 (4)
- PAX3 (4)
- PDGFC (4)
- WNT1 (4)
- KLF4 (3)
- NOTCH1 (3)
- SFRP1 (3)
- APOLIPOPROTEIN E (2)
- BMP2 (2)
- CD9 (2)
- DKK2 (2)
- ERBB 3 (2)
- GATA2 (2)
- HGF (2)
- IGFBP1 (2)
- IGFBP2 (2)
- KGF (2)
- LEF1 (2)
- LIF (2)
- PAX6 (2)
- WNT3A (2)
- WNT6 (2)
- BMP15 (1)
- BMP4 (1)
- BMP6 (1)
- BMP7 (1)
- CCN4 (1)
- CD34 (1)
- DKK1 (1)
- EGF (1)
- FGF10 (1)
- FGF21 (1)
- GDF 5 (1)
- GDF 9 (1)
- GDF3 (1)
- GDF7 (1)
- GLI2 (1)
- GLI3 (1)
- PAX7 (1)
- SFRP5 (1)
- SMURF 2 (1)
- TAL1 (1)
- WNT2 (1)
- WNT5A (1)
- WNT7B (1)
Conjugates
Modifications
Pathways
- Pathways in cancer (81)
- Cytokine-cytokine receptor interaction (51)
- Melanoma (50)
- MAPK signaling pathway (49)
- Regulation of actin cytoskeleton (48)
- Endocytosis (44)
- Focal adhesion (39)
- Prostate cancer (39)
- Gap junction (37)
- Dorso-ventral axis formation (35)
- Endometrial cancer (35)
- ErbB signaling pathway (35)
- Adherens junction (34)
- Calcium signaling pathway (34)
- Colorectal cancer (34)
- Bladder cancer (33)
- Glioma (33)
- Non-small cell lung cancer (33)
- Pancreatic cancer (33)
- Epithelial cell signaling in Helicobacter pylori infection (32)
- GnRH signaling pathway (32)
- Melanogenesis (21)
- Wnt signaling pathway (20)
- Basal cell carcinoma (18)
- Hedgehog signaling pathway (18)
- Hematopoietic cell lineage (16)
- Huntington's disease (16)
- Notch signaling pathway (14)
- Cell cycle (11)
- Chronic myeloid leukemia (11)
- Maturity onset diabetes of the young (11)
- Acute myeloid leukemia (10)
- TGF-beta signaling pathway (8)
- ECM-receptor interaction (5)
- Neurotrophin signaling pathway (5)
- Prion diseases (3)
- Alzheimer's disease (2)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (2)
- Cell adhesion molecules (CAMs) (2)
- Jak-STAT signaling pathway (2)
- Renal cell carcinoma (2)
- Thyroid cancer (2)
- Allograft rejection (1)
- Antigen processing and presentation (1)
- Autoimmune thyroid disease (1)
- Graft-versus-host disease (1)
- Type I diabetes mellitus (1)
- Ubiquitin mediated proteolysis (1)
- Viral myocarditis (1)