Antibodies

Jump to Filters
View as table Download
ENC1 Rabbit Polyclonal Antibody
TA335766

USD 539.00

5 Days

Rabbit Polyclonal Anti-ENC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ENC1 Antibody: synthetic peptide directed towards the N terminal of human ENC1. Synthetic peptide located within the following region: MSVSVHENRKSRASSGSINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLL
ENC1 Rabbit Polyclonal Antibody
TA375893

USD 365.00

3 Weeks

ENC1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human ENC1 (NP_003624.1).
Modifications Unmodified