Antibodies

Jump to Filters
View as table Download
SF3B14 (SF3B6) Rabbit Polyclonal Antibody
TA315491

USD 380.00

In Stock

Rabbit polyclonal anti-SF3B14 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human SF3B14.
SF3B14 (SF3B6) Rabbit Polyclonal Antibody
TA343838

USD 539.00

5 Days

Rabbit Polyclonal Anti-SF3B14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SF3B14 antibody: synthetic peptide directed towards the N terminal of human SF3B14. Synthetic peptide located within the following region: MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRV
SF3B14 (SF3B6) Rabbit Polyclonal Antibody
TA343839

USD 539.00

5 Days

Rabbit Polyclonal Anti-SF3B14 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SF3B14 antibody: synthetic peptide directed towards the middle region of human SF3B14. Synthetic peptide located within the following region: HLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK