Antibodies

View as table Download

Rabbit polyclonal anti-OR2A42 antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR2A42.

Rabbit Polyclonal Anti-OR2A42 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR2A42 antibody is: synthetic peptide directed towards the C-terminal region of Human OR2A42. Synthetic peptide located within the following region: FGSAIIMYMAPKSRHPEEQQKVFFLFYSFFNPTLNPLIYSLRNGEVKGAL