Antibodies

Jump to Filters
View as table Download
Epsin 2 (EPN2) Rabbit Polyclonal Antibody
AP01400PU-N

USD 445.00

3 Weeks

Epsin 2 (EPN2) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Epsin 2 (EPN2) Rabbit Polyclonal Antibody
TA315199

USD 380.00

4 Weeks

Rabbit polyclonal anti-EPN2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EPN2.
Epsin 2 (EPN2) Rabbit Polyclonal Antibody
TA329768

USD 539.00

5 Days

Rabbit polyclonal Anti-EPN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPN2 antibody: synthetic peptide directed towards the middle region of human EPN2. Synthetic peptide located within the following region: SHSEQEYGKAGGSPASYHGSTSPRVSSELEQARPQTSGEEELQLQLALAM
Epsin 2 (EPN2) Rabbit Polyclonal Antibody
TA329769

USD 539.00

5 Days

Rabbit polyclonal Anti-EPN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPN2 antibody: synthetic peptide directed towards the middle region of human EPN2. Synthetic peptide located within the following region: DPFESQPLTVASSKPSSARKTPESFLGPNAALVNLDSLVTRPAPPAQSLN
Epsin 2 (EPN2) Rabbit Polyclonal Antibody
TA347737

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-EPN2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-EPN2 Antibody: A synthesized peptide derived from human EPN2