Rabbit Polyclonal Anti-FKBP8 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FKBP8 |
Rabbit Polyclonal Anti-FKBP8 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FKBP8 |
Rabbit polyclonal anti-FKBP8 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This protein A purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human FKBP8 protein. |
Rabbit Polyclonal Anti-FKBP8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FKBP8 antibody: synthetic peptide directed towards the N terminal of human FKBP8. Synthetic peptide located within the following region: GPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLS |
Rabbit Polyclonal Anti-FKBP8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FKBP8 antibody: synthetic peptide directed towards the C terminal of human FKBP8. Synthetic peptide located within the following region: AIPILRAALKLEPSNKTIHAELSKLVKKHAAQRSTETALYRKMLGNPSRL |
Rabbit Polyclonal antibody to FKBP8 (FK506 binding protein 8, 38kDa)
Reactivities | Predicted: Human, Rhesus Monkey |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 42 and 276 of FKBP8 |