Antibodies

Jump to Filters
View as table Download
OR52E6 Rabbit Polyclonal Antibody
TA316413

USD 380.00

In Stock

Rabbit polyclonal anti-OR52E6 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human OR52E6.
OR52E6 Rabbit Polyclonal Antibody
TA332299

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR52E6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR52E6 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR52E6. Synthetic peptide located within the following region: FFSFFTHCFGHDIPQYIHIFLANLYVVVPPTLNPVIYGVRTKHIRETVLR