Antibodies

Jump to Filters
View as table Download
OR9G1 Rabbit Polyclonal Antibody
TA316429

USD 380.00

4 Weeks

Rabbit polyclonal anti-OR9G1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR9G1.
OR9G1 Rabbit Polyclonal Antibody
TA332287

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR9G1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR9G1 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR9G1. Synthetic peptide located within the following region: SILYIYALPRSSYSFDMDKIVSTFYTVVFPMLNLMIYSLRNKDVKEALKK
OR9G1 Rabbit Polyclonal Antibody
TA337517

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR9G1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR9G1 antibody is: synthetic peptide directed towards the C-terminal region of Human OR9G1. Synthetic peptide located within the following region: ILYIYALPRSSYSFDMDKIVSTFYTVVFPMLNLMIYSLRNKDVKEALKKL