Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal anti-TP53 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)
| Applications | IHC, WB |
| Reactivities | Human, Mouse (Predicted: Chicken, Rabbit, Rat, Xenopus, Bovine, X. tropicalis) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298) |
Rabbit Polyclonal anti-TP53 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit polyclonal Phospho-p53(T18) Antibody
| Applications | Dot, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Pig, Monkey, Rabbit) |
| Conjugation | Unconjugated |
| Immunogen | This p53 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T18 of human p53. |
| Modifications | Phospho-specific |
Rabbit polyclonal p53 Antibody (S315)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Monkey) |
| Conjugation | Unconjugated |
| Immunogen | This p53 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 293-322 amino acids from human p53. |
Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP |
Active filters
Antibody Hosts
- Rabbit
Clonalities
- Polyclonal
Conjugates
- Unconjugated
Families
- Transcription Factors
Pathways
- Amyotrophic lateral sclerosis (ALS)