Antibodies

Jump to Filters
View as table Download
PLAUR Rabbit Polyclonal Antibody
TA323492

USD 380.00

2 Weeks

Anti-PLAUR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 23-305 amino acids of human plasminogen activator, urokinase receptor
PLAT Rabbit Polyclonal Antibody
TA321237

USD 380.00

4 Weeks

Anti-PLAT Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 255-267 amino acids of human plasminogen activator, tissue
TA321237 is a possible alternative to TA321238.
Plasminogen (PLG) Rabbit Polyclonal Antibody
AP21382BT-N

USD 540.00

2 Weeks

Plasminogen (PLG) rabbit polyclonal antibody, Biotin

Applications ELISA, ID, IF, IP, R, WB
Reactivities Human
Conjugation Biotin
Immunogen Plasminogen isolated and purified from human plasma.
Freund’s complete adjuvant is used in the first step of the immunization procedure.
CD46 Rabbit Polyclonal Antibody
TA349781

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-CD46 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human CD46
Thrombomodulin (THBD) Rabbit Polyclonal Antibody
TA308080

USD 625.00

5 Days

Rabbit Polyclonal antibody to Thrombomodulin (thrombomodulin)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 512 and 575 of Thrombomodulin (Uniprot ID#P07204)
Complement C4B (C4B) Rabbit Polyclonal Antibody
TA346240

USD 539.00

5 Days

Rabbit Polyclonal Anti-C4B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C4B antibody: synthetic peptide directed towards the N terminal of human C4B. Synthetic peptide located within the following region: QTDQPIYNPGQRVRYRVFALDQKMRPSTDTITVMVENSHGLRVRKKEVYM
Heparin Cofactor II (SERPIND1) Rabbit Polyclonal Antibody
TA313999

USD 380.00

In Stock

Rabbit polyclonal Heparin Cofactor II antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Heparin Cofactor II.
Factor VIII (F8) Rabbit Polyclonal Antibody
TA325456

USD 380.00

4 Weeks

Rabbit Polyclonal Factor VIII Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human Factor VIII.
CD21 (CR2) Rabbit Monoclonal Antibody [Clone ID: EP3093]
TA327628

USD 1,095.00

5 Days

Rabbit Monoclonal CD21 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Heparin Cofactor II (SERPIND1) Rabbit Polyclonal Antibody
TA332957

USD 365.00

3 Weeks

Rabbit anti-SERPIND1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human SERPIND1
C2 Rabbit Polyclonal Antibody
TA346155

USD 539.00

5 Days

Rabbit Polyclonal Anti-C2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C2 antibody: synthetic peptide directed towards the N terminal of human C2. Synthetic peptide located within the following region: EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS