Antibodies

Jump to Filters
View as table Download
Nrf2 (NFE2L2) Rabbit Polyclonal Antibody
TA323944

USD 380.00

In Stock

Anti-NFE2L2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human nuclear factor (erythroid-derived 2)-like 2
Nrf2 (NFE2L2) Rabbit Polyclonal Antibody
TA343586

USD 485.00

5 Days

Rabbit Polyclonal Anti-NFE2L2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NFE2L2 antibody: synthetic peptide directed towards the C terminal of human NFE2L2. Synthetic peptide located within the following region: KEKGENDKSLHLLKKQLSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGN