Antibodies

Jump to Filters
View as table Download
IL18 Rabbit Polyclonal Antibody
TA324190

USD 380.00

2 Weeks

Anti-IL18 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Full length fusion protein
TA324190 is a possible alternative to TA324189.
TNF alpha (TNF) Rabbit Polyclonal Antibody
AP20373PU-N

USD 465.00

3 Weeks

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.
IL1 beta (IL1B) Rabbit Polyclonal Antibody
TA336742

USD 550.00

2 Weeks

Rabbit Polyclonal IL-1 beta/IL-1F2 Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide made to a C-terminal portion of the human IL 1 beta protein (between amino acids 100-200) [UniProt P01584]
LIF Rabbit Polyclonal Antibody
TA321468

USD 380.00

2 Weeks

Anti-LIF Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 34-47 amino acids of Human leukemia inhibitory factor
EGFR Rabbit Polyclonal Antibody
TA312545

USD 380.00

4 Weeks

Rabbit polyclonal EGFR (Ab-1172) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q).
SDF1 (CXCL12) (alpha) Rabbit Polyclonal Antibody
PP1067P1

USD 345.00

2 Weeks

SDF1 (CXCL12) (alpha) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly pure (>98%) E.coli derived recombinant Human SDF1-alpha (Cat.-No PA126)
Osteoprotegerin (TNFRSF11B) Rabbit Polyclonal Antibody
TA322994

USD 380.00

4 Weeks

Anti-TNFRSF11B Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 195-365 amino acids of human tumor necrosis factor receptor superfamily, member 11b
IL17B Receptor (IL17RB) Rabbit Polyclonal Antibody
TA351284

USD 380.00

In Stock

Rabbit Polyclonal Anti-IL17RB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human IL17RB
SDF1 (CXCL12) (alpha) Rabbit Polyclonal Antibody
PP1067P2

USD 465.00

2 Weeks

SDF1 (CXCL12) (alpha) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, FN, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Highly pure (>98%) E.coli derived recombinant Human SDF1-alpha (Cat.-No PA126)
IL10 (Center) Rabbit Polyclonal Antibody
AP52181PU-N

USD 580.00

2 Weeks

IL10 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated corresponding to the center region (between aa 27-53) of Human IL10.
TGF beta 1 (TGFB1) Rabbit Polyclonal Antibody
TA313319

USD 380.00

4 Weeks

Rabbit polyclonal anti-TGF Beta1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human TGF β1 antibody.
AMH Rabbit Polyclonal Antibody
TA336233

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-AMH Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AMH Antibody: synthetic peptide directed towards the middle region of human AMH. Synthetic peptide located within the following region: SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG
VEGFC Rabbit Polyclonal Antibody
TA321716

USD 380.00

2 Weeks

Anti-VEGFC Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 256-270 amino acids of human vascular endothelial growth factor C
TGF beta 1 (TGFB1) (N-term) Rabbit Polyclonal Antibody
AP54230PU-N

USD 580.00

2 Weeks

TGF beta 1 (TGFB1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 22-50 amino acids from the N-terminal region of Human TGFB1.
IL12A Rabbit Polyclonal Antibody
TA347881

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Interleukin 12A Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Interleukin 12A Antibody: A synthesized peptide derived from human Interleukin 12A