Rabbit polyclonal anti-HSPA1A(HSP70) antibody, Loading control
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse (Predicted: Sheep, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 308 and 569 of HSP70 1A |
Rabbit polyclonal anti-SFRS7 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SFRS7. |
Rabbit polyclonal anti-HSPA8(HSC70) antibody, Loading control
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HSPA8 |
Rabbit Polyclonal Anti-SFRS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SFRS1 antibody: synthetic peptide directed towards the C terminal of human SFRS1. Synthetic peptide located within the following region: EFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSR |
Germany
Japan
United Kingdom
China
