Antibodies

Jump to Filters
View as table Download
PLAUR Rabbit Polyclonal Antibody
TA323492

USD 380.00

2 Weeks

Anti-PLAUR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 23-305 amino acids of human plasminogen activator, urokinase receptor
PLAT Rabbit Polyclonal Antibody
TA321237

USD 380.00

4 Weeks

Anti-PLAT Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 255-267 amino acids of human plasminogen activator, tissue
TA321237 is a possible alternative to TA321238.
Factor VIII (F8) Rabbit Polyclonal Antibody
TA325456

USD 380.00

4 Weeks

Rabbit Polyclonal Factor VIII Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human Factor VIII.
Carboxypeptidase B2 (CPB2) Rabbit Polyclonal Antibody
AP17235PU-N

USD 580.00

2 Weeks

Carboxypeptidase B2 (CPB2) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected between 119~148 amino acids from the Center region of Human CPB2
C2 Rabbit Polyclonal Antibody
TA346155

USD 539.00

5 Days

Rabbit Polyclonal Anti-C2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C2 antibody: synthetic peptide directed towards the N terminal of human C2. Synthetic peptide located within the following region: EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS