Anti-GEMIN2 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 264-280 amino acids of human gem (nuclear organelle) associated protein 2 |
Rabbit Polyclonal Anti-SIP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SIP1 antibody: synthetic peptide directed towards the middle region of human SIP1. Synthetic peptide located within the following region: HSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS |
Germany
Japan
United Kingdom
China
