MS4A4A (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 40-68 amino acids from the N-terminal region of Human MS4A4A |
MS4A4A (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 40-68 amino acids from the N-terminal region of Human MS4A4A |
Rabbit Polyclonal Anti-MS4A4A Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MS4A4A antibody: synthetic peptide directed towards the N terminal of human MS4A4A. Synthetic peptide located within the following region: MHQTYSRHCRPEESTFSAAMTTMQGMEQAMPGAGPGVPQLGNMAVIHSHL |
Recombinant Anti-MS4A4A (Clone 5C12)
Applications | FC, IP |
Reactivities | Human |
Conjugation | Unconjugated |
Recombinant Anti-MS4A4A (Clone 3F2)
Applications | FC, IP |
Reactivities | Human |
Conjugation | Unconjugated |