Antibodies

Jump to Filters
View as table Download
DCK Rabbit Polyclonal Antibody
TA308454

USD 625.00

2 Weeks

Rabbit Polyclonal antibody to DCK (deoxycytidine kinase)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 260 of DCK (Uniprot ID#P27707)
DCK Rabbit Polyclonal Antibody
TA349644

USD 380.00

In Stock

Rabbit Polyclonal Anti-DCK Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human DCK
DCK Rabbit Polyclonal Antibody
TA327178

USD 365.00

3 Weeks

Rabbit anti-DCK Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human DCK
DCK Rabbit Polyclonal Antibody
TA339941

USD 539.00

5 Days

Rabbit Polyclonal Anti-DCK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCK antibody: synthetic peptide directed towards the middle region of human DCK. Synthetic peptide located within the following region: QLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQD
DCK Rabbit Polyclonal Antibody
TA339942

USD 539.00

5 Days

Rabbit Polyclonal Anti-DCK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCK antibody: synthetic peptide directed towards the middle region of human DCK. Synthetic peptide located within the following region: ATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQ