Antibodies

View as table Download

Anti-FABP7 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
TA323168 is a possible alternative to TA323167.

Rabbit Polyclonal FABP7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen FABP7 antibody was raised against a 17 amino acid peptide from near the center of human FABP7.

Rabbit Polyclonal Anti-FABP7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FABP7 antibody: synthetic peptide directed towards the N terminal of human FABP7. Synthetic peptide located within the following region: NFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISF