Antibodies

Jump to Filters
View as table Download
Protein Kinase A regulatory subunit I alpha (PRKAR1A) Rabbit Polyclonal Antibody
TA312524

USD 380.00

In Stock

Rabbit polyclonal anti-KAP0 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human KAP0.
Protein Kinase A regulatory subunit I alpha (PRKAR1A) Rabbit Polyclonal Antibody
TA344577

USD 539.00

5 Days

Rabbit Polyclonal Anti-PRKAR1A Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRKAR1A antibody: synthetic peptide directed towards the C terminal of human PRKAR1A. Synthetic peptide located within the following region: MNRPRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLS