Antibodies

View as table Download

GCDH (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 335-365 amino acids from the C-terminal region of Human GCD / GCDH

Rabbit Polyclonal Anti-GCDH Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GCDH Antibody: synthetic peptide directed towards the C terminal of human GCDH. Synthetic peptide located within the following region: IARQARDMLGGNGISDEYHVIRHAMNLEAVNTYEGTHDIHALILGRAITG

Rabbit Polyclonal Anti-Gcdh Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Gcdh Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LQLGRLKDQDKATPEMVSLLKRNNCGKALDIARQARDILGGNGISDEYHV

Rabbit Polyclonal Anti-GCDH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GCDH Antibody: synthetic peptide directed towards the N terminal of human GCDH. Synthetic peptide located within the following region: SLVMHPIYAYGSEEQRQKYLPQLAKGELLGCFGLTEPNSGSDPSSMETRA