ICA1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ICA1 |
ICA1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ICA1 |
Rabbit Polyclonal Anti-ICA1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ICA1 antibody: synthetic peptide directed towards the N terminal of human ICA1. Synthetic peptide located within the following region: SKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFS |
ICA1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ICA1 |
Rabbit Polyclonal Anti-ICA1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ICA1 antibody: synthetic peptide directed towards the C terminal of human ICA1. Synthetic peptide located within the following region: NMKDLQASLQEPAKAASDLTAWFSLFADLDPLSNPDAVGKTDKEHELLNA |