Antibodies

View as table Download

Rabbit Polyclonal Anti-HMGCL Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HMGCL

Rabbit Polyclonal Anti-BDH1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human BDH1

Rabbit Polyclonal Anti-OXCT1 Antibody

Applications WB
Reactivities Rat, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OXCT1 antibody: synthetic peptide directed towards the middle region of human OXCT1. Synthetic peptide located within the following region: GMYANLGIGIPLLASNFISPNITVHLQSENGVLGLGPYPRQHEADADLIN

Rabbit Polyclonal Anti-OXCT1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human OXCT1

Rabbit anti-ACAT2 polyclonal antibody

Applications WB
Reactivities Human, Rat, Sheep, Pig, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide derived from Human ACAT 2

Rabbit anti-ACAT1 polyclonal antibody

Applications WB
Reactivities Human, Porcine, Rat, Murine
Conjugation Unconjugated
Immunogen Synthetic peptide derived from Human ACAT1.

Rabbit Polyclonal Anti-Hmgcl Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Hmgcl Antibody is: synthetic peptide directed towards the C-terminal region of Rat Hmgcl. Synthetic peptide located within the following region: MGVSVVDSSVAGLGGCPYAKGASGNLATEDLVYMLTGLGIHTGVNLQKLL