Antibodies

View as table Download

Rabbit Polyclonal Anti-SLC6A3 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC6A3

Rabbit Anti-Dopamine Transporter, C-Terminus, Human Antibody

Applications WB
Reactivities Human, Monkey, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues from the intracellular C-terminal region conjugated to KLH

Rabbit Anti-Dopamine Transporter, Extracellular Loop 2, Human Antibody

Applications WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues from the extracellular loop 2 region conjugated to KLH

Rabbit Polyclonal Anti-SLC6A3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC6A3 Antibody: synthetic peptide directed towards the N terminal of human SLC6A3. Synthetic peptide located within the following region: HCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSH