Rabbit polyclonal RUNX2 Antibody (S533)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RUNX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 445-474 amino acids surrounding S533 of human RUNX2. |
Rabbit Polyclonal Anti-RUNX2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RUNX2 antibody: synthetic peptide directed towards the N terminal of human RUNX2. Synthetic peptide located within the following region: MRIPVDPSTSRRFSPPSSSLQPGKMSDVSPVVAAQQQQQQQQQQQQQQQQ |
RUNX2 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminal of human CBFA1 |
Rabbit Polyclonal RUNX2/CBFA1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Chicken, Equine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to somewhere between amino acids 250-300 of human RUNX2 was used as immunogen for this antibody.RUNX2 and RUNX1 share an approximate 66% homology in peptide sequence used as immunogen. |
Rabbit Polyclonal Anti-RUNX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RUNX2 antibody: synthetic peptide directed towards the middle region of human RUNX2. Synthetic peptide located within the following region: DTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRM |
Rabbit Polyclonal Anti-RUNX2 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RUNX2 antibody: synthetic peptide directed towards the C terminal of human RUNX2. Synthetic peptide located within the following region: TTTSNGSTLLNPNLPNQNDGVDADGSHSSSPTVLNSSGRMDESVWRPY |
Germany
Japan
United Kingdom
China
