Rabbit Polyclonal Anti-MXD3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MXD3 antibody: synthetic peptide directed towards the N terminal of human MXD3. Synthetic peptide located within the following region: MEPLASNIQVLLQAAEFLERREREAEHGYASLCPHRSPGPIHRRKKRPPQ |
Rabbit Polyclonal anti-MXD3 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MXD3 antibody: synthetic peptide directed towards the N terminal of human MXD3. Synthetic peptide located within the following region: PIHRRKKRPPQAPGAQDSGRSVHNELEKRRRAQLKRCLERLKQQMPLGAD |
Rabbit Polyclonal Anti-MXD3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MXD3 antibody is: synthetic peptide directed towards the C-terminal region of Human MXD3. Synthetic peptide located within the following region: RLRADSLDSSGLSSERSDSDQEELEVDVESLVFGGEAELLRGFVAGQEHS |
Germany
Japan
United Kingdom
China