Germany
Japan
United Kingdom
China
Antibodies
View as table Download
WNT3A Rabbit monoclonal antibody,clone OTIR4G6
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal antibody to WNT11 (wingless-type MMTV integration site family, member 11)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Chicken, Rat, Xenopus, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 310 of WNT11 (Uniprot ID#O96014) |
Rabbit Polyclonal anti-GNAS antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV |
Rabbit Polyclonal Anti-WNT5A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT5A antibody: synthetic peptide directed towards the middle region of human WNT5A. Synthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT |
Rabbit Polyclonal anti-GNAS antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: VYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSD |
Rabbit Polyclonal antibody to GNAS (GNAS complex locus)
| Applications | IHC, WB |
| Reactivities | Human, Mouse (Predicted: Dog, Pig, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 807 and 1037 of GNAS (Uniprot ID#Q5JWF2) |
Rabbit polyclonal WNT5B Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Rabbit, Xenopus) |
| Conjugation | Unconjugated |
| Immunogen | This WNT5B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 153-182 amino acids from the Central region of human WNT5B. |
Rabbit polyclonal WNT10B Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This WNT10B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 193-222 amino acids from the Central region of human WNT10B. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Antibody Hosts
- Rabbit
Families
- Secreted Protein
Pathways
- Melanogenesis