Rabbit monoclonal HSD17B13 Antibody,Clone OTIR5C10
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal HSD17B13 Antibody,Clone OTIR5C10
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-CCL26 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 57-71 amino acids of Human chemokine (C-C motif) ligand 26 |
Rabbit Polyclonal Anti-SMOC2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SMOC2 |
Rabbit monoclonal HSD17B13 Antibody,Clone OTIR3G2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ISG15 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ISG15 antibody: synthetic peptide directed towards the middle region of human ISG15. Synthetic peptide located within the following region: EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK |
Anti-TTR Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
CD8 Rabbit monoclonal antibody,clone OTIR3D5
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-CTGF Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 148-159 amino acids of Human Connective tissue growth factor |
Anti-IL1RAP Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 22-356 amino acids of Human Interleukin-1 receptor accessory protein |
Anti-IL18 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
AMH Capture Rabbit Monoclonal antibody,clone OTIR5D9
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700549 |
USD 494.00
In Stock
AMH biotinylated detection Rabbit Monoclonal antibody,clone OTIR5C11
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Biotin |
Matched ELISA Pair | TA600549 |
USD 494.00
2 Weeks
BNP Biotinylated Detection Rabbit Monoclonal Antibody, Clone OTIR5D11
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Biotin |
Rabbit Polyclonal PON1 Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Dog, Rat |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Anti-AACT Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 290-303 amino acids of Human Alpha-1-antichymotrypsin |