Antibodies

Jump to Filters
View as table Download
SIRP alpha (SIRPA) Rabbit Polyclonal Antibody
TA313227

USD 380.00

4 Weeks

Rabbit polyclonal anti-Sirp a1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human SIRP-alpha1.
SIRP alpha (SIRPA) Rabbit Polyclonal Antibody
AP06316PU-N

USD 445.00

3 Weeks

SIRP alpha (SIRPA) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 450-500 of Human SIRP-α1.
SIRP alpha (SIRPA) Rabbit Polyclonal Antibody
TA330311

USD 539.00

5 Days

Rabbit Polyclonal Anti-SIRPA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SIRPA antibody: synthetic peptide directed towards the C terminal of human SIRPA. Synthetic peptide located within the following region: QTSPQPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK
SIRP alpha (SIRPA) Rabbit Polyclonal Antibody
TA347471

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-SHPS1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SHPS1 Antibody: A synthesized peptide derived from human SHPS1