Antibodies

Jump to Filters
View as table Download
FOLH1B Rabbit Polyclonal Antibody
TA351197

USD 380.00

In Stock

Rabbit Polyclonal Anti-FOLH1B Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human FOLH1B
FOLH1B Rabbit Polyclonal Antibody
TA367057

USD 380.00

4 Weeks

FOLH1B rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human FOLH1B
FOLH1B (C-term) Rabbit Polyclonal Antibody
AP53485PU-N

USD 580.00

2 Weeks

FOLH1B (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 402-431 amino acids from the C-terminal region of Human PSMAL
FOLH1B Rabbit Polyclonal Antibody
TA337314

USD 539.00

5 Days

Rabbit Polyclonal Anti-FOLH1B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FOLH1B antibody is: synthetic peptide directed towards the middle region of Human FOLH1B. Synthetic peptide located within the following region: ELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLG