DERA (N-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide selected from the N-term region of human DERA |
DERA (N-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide selected from the N-term region of human DERA |
Rabbit Polyclonal Anti-DERA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DERA antibody is: synthetic peptide directed towards the N-terminal region of Human DERA. Synthetic peptide located within the following region: KKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIREDLLKALN |