Antibodies

Jump to Filters
View as table Download
CDT1 Rabbit Polyclonal Antibody
TA339369

USD 539.00

5 Days

Rabbit Polyclonal Anti-CDT1 Antibody

Applications IHC, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CDT1 antibody: synthetic peptide directed towards the C terminal of human CDT1. Synthetic peptide located within the following region: PATPPATPPAASPSALKGVSQDLLERIRAKEAQKQLAQMTRCPEQEQRLQ