CD8 Rabbit monoclonal antibody,clone OTIR3D5
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
CD8 Rabbit monoclonal antibody,clone OTIR3D5
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal anti-CD40 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human CD40. |
Rabbit Polyclonal Anti-CD40 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CD40 |
CD8 Rabbit monoclonal antibody,clone OTIR3D5
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
CD40L (CD40LG) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a sequence at the N-terminal of human CD40L |
ICOS Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ICOS |
Anti-ICOS Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 21-140 amino acids of human inducible T-cell co-stimulator |
Rabbit Polyclonal Anti-CD40LG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD40LG antibody: synthetic peptide directed towards the middle region of human CD40LG. Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN |
Rabbit Polyclonal Anti-CD40LG Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CD40LG |
Rabbit anti CD8 Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
CD40 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminal of mouse CD40 |
Rabbit Polyclonal anti-CD8B antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD8B antibody: synthetic peptide directed towards the middle region of human CD8B. Synthetic peptide located within the following region: LCCRRRRARLRFMKQPQGEGISGTFVPQCLHGYYSNTTTSQKLLNPWILK |
Rabbit Polyclonal Anti-CD40 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: SQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCD |
Rabbit Polyclonal Anti-CD40 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV |
Rabbit Polyclonal Anti-CD8B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD8B antibody: synthetic peptide directed towards the N terminal of human CD8B. Synthetic peptide located within the following region: RIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFI |