Antibodies

Jump to Filters
Download
Tau (MAPT) Rabbit Monoclonal Antibody [Clone ID: OTIR3B5]
TA592996

USD 428.00

In Stock

P-tau217 Rabbit monoclonal antibody,clone OTIR3B5

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Tau (MAPT) Rabbit Monoclonal Antibody [Clone ID: OTIR5E7]
TA592997

USD 428.00

In Stock

Ac-tau281 Rabbit monoclonal antibody,clone OTIR5E7

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Tau (MAPT) Rabbit Monoclonal Antibody [Clone ID: OTIR5D9]
TA594006

USD 428.00

In Stock

Ac-tau281 Rabbit monoclonal antibody,clone OTIR5D9

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Tau (MAPT) Rabbit Monoclonal Antibody [Clone ID: OTIR5B10]
TA594007

USD 428.00

In Stock

Ac-tau281 Rabbit monoclonal antibody,clone OTIR5B10

Applications ELISA
Reactivities Human
Conjugation Unconjugated
P-Tau181 Rabbit monoclonal antibody [Clone ID: OTIR1C12]
TA594030

USD 428.00

In Stock

P-tau181 Rabbit monoclonal antibody,clone OTIR1C12

Applications ELISA
Reactivities Human
Conjugation Unconjugated
P-Tau181 Rabbit monoclonal antibody [Clone ID: OTIR5A6]
TA594032

USD 428.00

In Stock

P-tau181 Rabbit monoclonal antibody,clone OTIR5A6

Applications ELISA
Reactivities Human
Conjugation Unconjugated
P-Tau181 Rabbit monoclonal antibody [Clone ID: OTIR2F8]
TA594034

USD 428.00

In Stock

P-tau181 Rabbit monoclonal antibody,clone OTIR2F8

Applications ELISA
Reactivities Human
Conjugation Unconjugated
NF-kB p65 (RELA) Rabbit Polyclonal Antibody
TA890246

USD 400.00

In Stock

RELA Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide (the amino acid sequence is considered to be commercially sensitive) within Human RELA (NP_068810). The exact sequence is proprietary.
NFKB1 Rabbit Polyclonal Antibody
TA309944

USD 565.00

3 Weeks

Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L).
Modifications Phospho-specific
AKT1 Rabbit Polyclonal Antibody
TA313266

USD 380.00

2 Weeks

Rabbit polyclonal Akt (Ser473) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Akt
Modifications Phospho-specific
AKT2 Rabbit Polyclonal Antibody
TA590729

USD 482.00

In Stock

Rabbit Polyclonal AKT2 Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
p53 (TP53) Rabbit Polyclonal Antibody
TA329140

USD 539.00

5 Days

Rabbit Polyclonal anti-TP53 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE
c-Jun (JUN) Rabbit Polyclonal Antibody
TA590119

USD 482.00

In Stock

Rabbit Polyclonal c-jun Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.
B Raf (BRAF) Rabbit Polyclonal Antibody
TA321643

USD 380.00

2 Weeks

Anti-BRAF Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 71-86 amino acids of Human v-raf murine sarcoma viral oncogene homolog B1
IL1 Receptor I (IL1R1) Rabbit Polyclonal Antibody
TA323543

USD 380.00

2 Weeks

Anti-IL1R1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 209 amino acids of human interleukin 1 receptor, type I