Antibodies

Jump to Filters
View as table Download
PTPN13 Rabbit Polyclonal Antibody
TA351181

USD 380.00

In Stock

Rabbit Polyclonal Anti-PTPN13 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human PTPN13
PTPN13 Rabbit Polyclonal Antibody
TA371343

USD 380.00

4 Weeks

PTPN13 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human PTPN13
PTPN13 Rabbit Polyclonal Antibody
TA380530

USD 365.00

3 Weeks

PTPN13 Rabbit polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 250-500 of human PTPN13 (NP_542416.1).
Modifications Unmodified
PTPN13 Rabbit Polyclonal Antibody
TA343796

USD 539.00

5 Days

Rabbit Polyclonal Anti-EWSR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EWSR1 antibody: synthetic peptide directed towards the N terminal of human EWSR1. Synthetic peptide located within the following region: PQVPGSYPMQPVTAPPSYPPTSYSSTQPTSYDQSSYSQQNTYGQPSSYGQ