Antibodies

Jump to Filters
View as table Download
OR9A2 Rabbit Polyclonal Antibody
TA316111

USD 380.00

In Stock

Rabbit polyclonal anti-OR9A2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OR9A2.
OR9A2 Rabbit Polyclonal Antibody
TA332349

USD 539.00

5 Days

Rabbit Polyclonal Anti-OR9A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-OR9A2 Antibody is: synthetic peptide directed towards the C-terminal region of Human OR9A2. Synthetic peptide located within the following region: VKPKQTQGVEYNKIVSLLVSVLTPFLNPFIFTLRNDKVKEALRDGMKRCC