Antibodies

Jump to Filters
View as table Download
EFEMP1 (N-term) Rabbit Polyclonal Antibody
AP51374PU-N

USD 580.00

2 Weeks

EFEMP1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 126-156aa) of human Fibulin-3
EFEMP1 Rabbit Polyclonal Antibody
TA306794

USD 570.00

5 Days

Rabbit Polyclonal Fibulin 3 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fibulin 3 antibody was raised against a 19 amino acid peptide near the carboxy terminus of human Fibulin 3.
EFEMP1 Rabbit Polyclonal Antibody
TA312976

USD 380.00

In Stock

Rabbit polyclonal anti-EFEMP1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EFEMP1.
EFEMP1 Rabbit Polyclonal Antibody
TA346066

USD 539.00

5 Days

Rabbit Polyclonal Anti-EFEMP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EFEMP1 antibody: synthetic peptide directed towards the middle region of human EFEMP1. Synthetic peptide located within the following region: NENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRTSSV
EFEMP1 Rabbit Polyclonal Antibody
AP21171PU-N

USD 445.00

3 Weeks

EFEMP1 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
EFEMP1 Rabbit Polyclonal Antibody
TA346013

USD 539.00

5 Days

Rabbit Polyclonal Anti-EFEMP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EFEMP1 antibody: synthetic peptide directed towards the middle region of human EFEMP1. Synthetic peptide located within the following region: GNENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRTSS
EFEMP1 Rabbit Polyclonal Antibody
TA346014

USD 539.00

5 Days

Rabbit Polyclonal Anti-EFEMP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EFEMP1 antibody: synthetic peptide directed towards the middle region of human EFEMP1. Synthetic peptide located within the following region: KYMSIRSDRSVPSDIFQIQATTIYANTINTFRIKSGNENGEFYLRQTSPV