Rabbit Polyclonal Antibody against CGI58
Applications | Simple Western, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region within residues 200-300 of the human protein. [Swiss-Prot# Q8WTS1] |
Rabbit Polyclonal Antibody against CGI58
Applications | Simple Western, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region within residues 200-300 of the human protein. [Swiss-Prot# Q8WTS1] |
Anti-ABHD5 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 297 amino acids of human abhydrolase domain containing 5 |
Rabbit Polyclonal Anti-ABHD5 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ABHD5 antibody: synthetic peptide directed towards the C terminal of human ABHD5. Synthetic peptide located within the following region: SVIFGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQK |
Rabbit Polyclonal Anti-ABHD5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ABHD5 antibody: synthetic peptide directed towards the N terminal of human ABHD5. Synthetic peptide located within the following region: NRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCALGLDKMILL |