Antibodies

View as table Download

Rabbit Polyclonal Antibody against CGI58

Applications Simple Western, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region within residues 200-300 of the human protein. [Swiss-Prot# Q8WTS1]

Anti-ABHD5 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 297 amino acids of human abhydrolase domain containing 5

Rabbit Polyclonal Anti-ABHD5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ABHD5 antibody: synthetic peptide directed towards the C terminal of human ABHD5. Synthetic peptide located within the following region: SVIFGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQK

Rabbit Polyclonal Anti-ABHD5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ABHD5 antibody: synthetic peptide directed towards the N terminal of human ABHD5. Synthetic peptide located within the following region: NRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCALGLDKMILL