Rabbit Polyclonal Anti-IL17D Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human IL17D |
Rabbit Polyclonal Anti-IL17D Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human IL17D |
IL17D (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 154-183 amino acids from the C-terminal region of Human IL17D |
Rabbit Polyclonal Anti-IL17D Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IL17D antibody: synthetic peptide directed towards the N terminal of human IL17D. Synthetic peptide located within the following region: MLVAGFLLALPPSWAAGAPRAGRRPARPRGCADRPEELLEQLYGRLAAGV |
IL17D rabbit polyclonal antibody, Biotin
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Biotin |
Immunogen | Highly pure recombinant Human IL-17D. |
IL17D rabbit polyclonal antibody, Biotin
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Biotin |
Immunogen | Highly pure recombinant Human IL-17D. |
IL17D rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Highly pure recombinant Human IL-17D. |
IL17D rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Highly pure recombinant Human IL-17D. |